PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10425867g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 419aa    MW: 47388.2 Da    PI: 9.8419
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10425867g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.63e-18449147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  MA_10425867g0020  4 RGHWRPAEDEKLRELVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 49
                      899*****************************.***********996 PP

2Myb_DNA-binding591e-185699146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      r ++T+eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
  MA_10425867g0020 56 RRPFTEEEEERLLAAHRLHGNK-WAMIARLFP-GRTDNAVKNHWHV 99
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.724154IPR017930Myb domain
SMARTSM007173.7E-15352IPR001005SANT/Myb domain
SuperFamilySSF466891.39E-29397IPR009057Homeodomain-like
PfamPF002492.0E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-27557IPR009057Homeodomain-like
CDDcd001672.94E-14748No hitNo description
SMARTSM007179.2E-1655103IPR001005SANT/Myb domain
PROSITE profilePS5129422.555105IPR017930Myb domain
PfamPF002494.1E-155698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2158104IPR009057Homeodomain-like
CDDcd001671.83E-76798No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MCPRGHWRPA EDEKLRELVE QYGPQNWNSI AEKLQGRSGK SCRLRWFNQL DPRINRRPFT  60
EEEEERLLAA HRLHGNKWAM IARLFPGRTD NAVKNHWHVI MARKFRERSR IYGKRRSSCG  120
HLMRKARPHS AHAPEHIEEN SLSTFIDMYY RGCHEDAGIS SSNILGRRPR KLPHDSTLEN  180
MNSQIHGNGL ILNPSGRSER LEVVTPQGRP ASTESEAYKN RILDSLCEIG INNHVQSRKN  240
LQDFFFQQSM RPAASKVPSA TSWLPIFSGS TLPKAPDLAQ GEFRPDHFPC PEPGKINGCL  300
KIPPIYNYSS SSFRHRTTDH RGPGAVAEAK EAQLISPELL KGSTASSYSP ASLQLSINPQ  360
SSPSSTFKEA KVVHQNKSHN GRDRNPYNIL ESQVADHEIT DPDQRKEAAF IDFLGVGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-3241047107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6010660.0EF601066.1 Picea glauca R2R3-MYB transcription factor MYB3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ27IN90.0Q27IN9_PINTA; R2R3-MYB transcription factor MYB3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-57myb domain protein 105